45
8
3
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T5522 | NMDAR antagonist 1 | Others , iGluR | |
NMDAR antagonist 1 is an orally active, NR2B-selective NMDAR antagonist. | |||
T72662 | NMDAR/TRPM4-IN-2 | ERK , TRP/TRPV Channel , NMDAR , iGluR | |
NMDAR/TRPM4-IN-2 is a potent interfacial inhibitor of NMDAR/TRPM4 interaction.NMDAR/TRPM4-IN-2 protects against MCAO-induced brain damage and NMDA-induced retinal ganglion cell loss in mice.NMDAR/TRPM4-IN-2 has neuroprot... | |||
T61451 | NMDAR/HDAC-IN-1 | ||
NMDAR/HDAC-IN-1 (Compound 9d) is a potent dual inhibitor of N-methyl-D-aspartate receptors (NMDARs) and histone deacetylases (HDACs). It exhibits a high affinity (Ki = 0.59 μM) for NMDARs, while demonstrating significant... | |||
T62126 | (Rac)-NMDAR antagonist 1 | ||
(Rac)-NMDAR antagonist 1 is a racemate of NMDAR antagonist 1. NMDAR antagonist 1 is a potent, orally active, NR2B-selective NMDAR antagonist. | |||
T74854 | GluN2B-NMDAR antagonist-1 | ||
GluN2B-NMDAR Antagonist-1, an orally active compound, functions as a GluN2B-NMDAR antagonist with neuroprotective properties. It is applicable in the research of ischemic injury [1]. | |||
T7870 | TCN 201 | TCN-201 | NMDAR , iGluR |
TCN 201 is a selective antagonist of NMDA receptors containing the NR2A subunit. | |||
T2556 | Nandrolone decanoate | 19-Nortestosterone decanoate | Others , HIV Protease |
Nandrolone decanoate (19-Nortestosterone decanoate) is the decanoate salt form of nandrolone, an anabolic steroid analog of testosterone with androgenic, anabolic, and erythropoietin stimulating effects. Nandrolone enter... | |||
T6504 | Flupirtine maleate | Katadolon maleate | Potassium Channel , NMDAR , iGluR |
Flupirtine maleate (Katadolon maleate), a centrally acting non-opioid analgesia, is the salt form of Flupirtine. It is an NMDA receptor antagonist , and also a specific neuronal potassium channel opener. | |||
T0556 | 6-Methoxy-2-naphthoic acid | Naproxen impurity O,6-Methoxy-2-naphthalenecarboxylic acid | NMDAR , iGluR |
6-Methoxy-2-naphthoic acid (6-Methoxy-2-naphthalenecarboxylic acid) is an modulator of NMDAR. | |||
T8450 | TCN 213 | TCN213 | NMDAR |
TCN 213 is an antagonist of NMDA receptor that has a selective for NR1/NR2A over NR1/NR2B | |||
T13112L1 | Tat-NR2B9c acetate | Tat-NR2B9c acetate (500992-11-0 Free base),NA-1 acetate | Others |
Tat-NR2B9c acetate (NA-1 acetate) is a postsynaptic density-95 (PSD-95) inhibitor, with EC50 values of 6.7 nM and 670 nM for PSD-95d2 (PSD-95 PDZ domain 2) and PSD-95d1, respectively. Tat-NR2B9c acetate disrupts the PSD-... | |||
T7355 | IC87201 | Others , iGluR | |
IC87201 is a nNOS-PDZ/PSD-95-PDZ inhibitor. IC87201 showed great promise in cellular experiments and animal models of ischemic stroke and pain. | |||
T10781 | CGP 78608 hydrochloride | PAMQX | NMDAR , iGluR |
CGP 78608 hydrochloride is a specific antagonist at the glycine binding site of the NMDA receptor (IC50 = 6 nM). CGP 78608 hydrochloride exhibits anticonvulsant activity. CGP 78608 hydrochloride potentiates GluN1/GluN3A-... | |||
T4171 | PEAQX | NVP-AAM077 | NMDAR , iGluR |
PEAQX (NVP-AAM077)(NVP-AAM 077) is an effective and orally available NMDA antagonist. It can inhibit human NMDA receptors for 1A/2A(IC50: 270 nM), rather than 1A/2B(29, 600 nM). | |||
T22798 | Gavestinel | GV 150526,Gavestinel sodium salt | NMDAR , iGluR |
Gavestinel (GV 150526) is a non-competitive NMDA receptor antagonist that is potent, selective and orally active.Gavestinel binds to the glycine site of the NMDA receptor with a binding affinity (pKi value) of 8.5.Gavest... | |||
TQ0233 | Traxoprodil | CP101606 | NMDAR , iGluR |
Traxoprodil (CP101606) is a selective NMDA antagonist and protects hippocampal neurons (IC50: 10 nM). | |||
T3320 | Dizocilpine Maleate | (+)-Mk-801 Hydrogen Maleate,MK 801,Dizocilpine hydrogen maleate,(+)-MK 801 maleate,(+)-MK 801 (Maleate) | NMDAR , iGluR |
Dizocilpine Maleate (MK 801) is a potent noncompetitive antagonist of the NMDA receptor (RECEPTORS, N-METHYL-D-ASPARTATE) with Kd of 37.2 nM in rat brain membranes. The drug has been considered for the wide variety of ne... | |||
T1946 | Felbamate | W-554,ADD-03055 | NMDAR , iGluR |
Felbamate (W-554) is an Anti-epileptic Agent. The physiologic effect of felbamate is by means of Decreased Central Nervous System Disorganized Electrical Activity. | |||
T16451 | PEAQX tetrasodium hydrate | NVP-AAM077 tetrasodium hydrate,PEAQX tetrasodium hydrate (459836-30-7 free base),PEAQX tetrasodium hydrate | Apoptosis , NMDAR , iGluR |
PEAQX tetrasodium hydrate (PEAQX tetrasodium hydrate (459836-30-7 free base)) is an orally available NMDA antagonist that is potent and selective. The IC50 value of PEAQX tetrasodium hydrate (459836-30-7 free base) again... | |||
T1308 | Orphenadrine hydrochloride | Mebedrol,Mephenamin | Sodium Channel , NMDAR , Norepinephrine , iGluR , Histamine Receptor |
Orphenadrine hydrochloride (Mephenamin) is a muscarinic antagonist used to treat drug-induced parkinsonism and to relieve pain from muscle spasm. | |||
T15408 | GNE 5729 | Others | |
GNE 5729 is an NMDAR of brain permeable positive allosteric modulator (EC50: 37 nM for GluN2A; 4.7 and 9.5 μM for GluN2C and GluN2D, respectively). | |||
T3407 | Rapastinel | GLYX-13,Thr-Pro-Pro-Thr-NH2,TPPT-amide | NMDAR , iGluR |
Rapastinel (TPPT-amide) (GLYX-13) is an N-methyl-D-aspartate receptor (NMDAR) modulator. | |||
T62376 | GNE-9278 | ||
GNE-9278 is a highly selective NMDAR orthosteric modulator that acts on the GluN1 transmembrane structural domain (TMD).GNE-9278 acts on activated NMDAR and increases peak current and agonist affinity. | |||
T82296 | GluN1(359-378) | ||
GluN1 (359-378) is an antibody targeting the N-methyl-D-aspartate receptor (NMDAR) capable of crossing the blood-brain barrier and is utilized in researching therapies for anti-NMDAR encephalitis that focus on the immune... | |||
T12733 | Rislenemdaz | CERC-301,MK-0657 | iGluR |
Rislenemdaz (CERC-301) (CERC-301) is an antagonist of the N-methyl-D-aspartate (NMDA) receptor subunit 2B (GluN2B). | |||
T24917 | UBP684 | UBP-684,UBP 684 | |
UBP684 is an NMDAR pan-PAM. UBP684 increases the maximal l-glutamate/glycine response while having minor subunit-specific effects on agonist potency. It robustly potentiates responses at all GluN1/GluN2 subtypes and at n... | |||
T82297 | GluN1(356-385) | ||
GluN1 (356-385) is an antigenic peptide implicated in N-methyl-D-aspartate receptor (NMDAR) encephalitis and has been shown to decrease the density of NMDAR surface clusters in hippocampal neurons. It serves as a tool to... | |||
T15407 | GNE-0723 | Others | |
GNE 0723 is an NMDAR brain permeable positive allosteric modulator (EC50: 21 nM for GluN2A; 7.4 and 6.2 μM for GluN2C and GluN2D, respectively). | |||
T79611 | DQP-26 | iGluR | |
DQP-26, a potent negative allosteric modulator of NMDA receptors (NMDARs), exhibits IC50 values of 0.77 μM for GluN2C and 0.44 μM for GluN2D subunits, indicating potential application in research on NMDAR-associated neur... | |||
T76078 | Neurogranin (48-76), mouse | ||
Neurogranin (48-76), mouse, is a peptide comprising residues 48-76 of Neurogranin, a post-synaptically exclusive calmodulin-binding protein that mediates NMDAR-driven synaptic plasticity by regulating the calcium-calmodu... | |||
T24919 | UBP714 | UBP 714,UBP-714 | |
UBP714 is a derivative of the NMDA receptor negative allosteric modulator UBP608. It also enhanced NMDAR mediated field EPSPs in the CA1 region of the hippocampus. UBP714 is a novel template for the development of potent... | |||
T60306 | NMDA receptor antagonist 4 | ||
NMDA receptor antagonist 4 (IIc) is an uncompetitive, voltage-dependent, orally active NMDAR blocker, with an IC 50 of 1.93 μM. NMDA receptor antagonist 4 shows a positive predicted blood-brain-barrier (BBB) permeability... | |||
T8435 | YM90K | YM90K hydrochloride,6-(1H-imidazol-1-yl)-7-nitro-2,3(1H,4H)- | GluR , iGluR |
YM90K (6-(1H-imidazol-1-yl)-7-nitro-2,3(1H,4H)-) hydrochloride is an antagonist of AMPA receptor. | |||
T73491 | TP-050 | ||
TP-050 is a potent, selective NMDAR agonist that is orally active, showing EC50 values of 0.51 µM for GluN2A and 9.6 µM for GluN2D. This compound can cross the blood-brain barrier (BBB), enhancing hippocampal long-term (... | |||
TP1023 | NT 13 | TPPT | |
NT 13 is a partial N-methyl-D-aspartate receptor (NMDAR) agonist used in the study of depression, anxiety, and other related diseases. | |||
T73359 | NYX-2925 | ||
NYX-2925, an orally active NMDAR (N-methyl-D-aspartate receptor) modulator, enhances activated Src levels and Src phosphorylation at GluN2A and GluN2B sites in the mPFC (medial prefrontal cortex), without affecting CAMKI... | |||
T82528 | DQP-997-74 | ||
Dihydroquinoline-pyrazoline DQP-997-74 (compound 2i) is a selective N-methyl-d-aspartate receptor (NMDAR) inhibitor that preferentially targets GluN2C/D subunits, with IC50 values of 0.069 μM and 0.035 μM, respectively, ... | |||
T76250 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | ||
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, offering a p... | |||
T76250L | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA | ||
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, demonstrati... | |||
T80210 | TAT-GluN2BCTM | DAPK | |
TAT-GluN2BCTM is a membrane-permeable peptide that selectively targets active DAPK1 (Death-associated protein kinase 1) for lysosomal degradation, thereby protecting neurons against oxidative stress and NMDAR-mediated ex... | |||
T35924 | Tat-NR2Baa | Tat-NR2Baa | |
Tat-NR2BAA is an inactive control peptide of Tat-NR2B9c. It shares a similar sequence with Tat-NR2B9c, but possesses a double-point mutation in the COOH terminal tSXV motif. This mutation renders Tat-NR2BAA unable to bin... | |||
T0802 | Procaine hydrochloride | Novocaine HCl,Procaine HCl | Histone Demethylase , 5-HT Receptor , DNA/RNA Synthesis , Sodium Channel , NMDAR , AChR |
Procaine hydrochloride (Novocaine HCl) is the hydrochloride salt form of procaine, a benzoic acid derivative with local anesthetic and antiarrhythmic properties. Procaine binds to and inhibits voltage-gated sodiumchannel... | |||
T76069 | Tat-NR2Baa TFA | ||
Tat-NR2BAA TFA serves as the inactive control peptide for Tat-NR2B9c, featuring a comparable sequence with a crucial distinction: a double-point mutation in its COOH-terminal tSXV motif. This alteration renders Tat-NR2BA... | |||
T23231 | Remacemide hydrochloride | Others | |
Remacemide hydrochloride is a NMDA receptor antagonist. | |||
T22435 | Tacrine hydrochloride | Tacrine HCl | Others |
Tacrine is a indirect cholinergic agonist and centrally acting anticholinesterase. Tacrine hydrochloride hydrate is an inhibitor of acetyl (AChE) and butyryl-cholinestrase (BChE) with IC50s of 31 nM and 25.6 nM, respecti... |
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T6975 | Sarcosine | Sarcosinic acid,Methylaminoacetic acid,Sarcosin,Methylglycine,N-Methylaminoacetic acid,N-methylglycine | Others , GlyT , Endogenous Metabolite |
Sarcosine (Methylglycine) is a competitive inhibitor of the type I glycine transporter (GlyT1) and an N-methyl-D-aspartate receptor (NMDAR) co-agonist. | |||
T8394 | D-Serine | (R)-Serine | Endogenous Metabolite , NMDAR , iGluR |
D-Serine ((R)-Serine) is an endogenous amino acid,is a potent co-agonist at the NMDA glutamate receptor. | |||
T3826 | Polygalasaponin F | NF-κB , TLR , Akt , PI3K | |
Polygalasaponin F has anti-neuroinflammatory activity, can inhibit the release of inflammatory cytokines TNF-α and NO induced by lipopolysaccharides (LPS) and reduce the expression of inducible nitric oxide synthases. Po... | |||
T1186 | Ifenprodil Tartrate | Potassium Channel , NMDAR , iGluR | |
Ifenprodil is a selective NMDA receptor (glutamate) antagonist. | |||
T4752 | 1-Aminocyclopropane-1-carboxylic acid | 1-Aminocyclopropanecarboxylic acid,1-Amino-1-carboxycyclopropane,ACC | Endogenous Metabolite , NMDAR |
1-Aminocyclopropane-1-carboxylic acid (ACC) is an intermediate in the synthesis of ethylene, the plant hormone responsible for biological processes ranging from seed germination to organ senescence. It is a small molecul... | |||
T75571 | Withaphysalin D | ||
Withaphysalin D, isolated from water lilies, is a selective antagonist for the N-methyl-D-aspartate receptor (NMDAR) containing GluN2B with neuroprotective properties. This compound is capable of crossing the blood-brain... | |||
T79959 | 6-Hydroxykynurenic acid | 6-HKA | iGluR |
6-Hydroxykynurenic acid (6-HKA), a kynurenic acid (KYNA) derivative isolated from Ginkgo leaves, functions as a low-affinity NMDAR antagonist with an IC50 of 59 μM [1]. | |||
T0051 | Urethane | Ethyl carbamate,Ethylurethane,Carbamic acid ethyl ester | Chloride channel , GABA Receptor , Antibacterial , GluR , NMDAR , AChR , Parasite |
Urethane (Ethylurethane) was an antineoplastic agent .Now is used for other medicinal purposes. |
Cat No. | Product Name | Species | Expression System |
---|---|---|---|
TMPY-01692 | NETO1 Protein, Human, Recombinant (His) | Human | HEK293 |
Neuropilin tolloid-like 1 (NETO1), a complement C1r/C1s, Uegf, Bmp1 (CUB) domain-containing transmembrane protein, is a novel component of the NMDAR complex critical for maintaining the abundance of NR2A-containing NMDAR... | |||
TMPY-01726 | Neuroligin-1 Protein, Human, Recombinant (His) | Human | HEK293 |
Neuroligin 1 (NLGN1) belongs to the type-B carboxylesterase/lipase family, is a synaptic cell-adhesion molecule that is enriched in postsynaptic densities where it may recruit receptors, channels, and signal-transduction... | |||
TMPY-02750 | Neuroligin-1 Protein, Mouse, Recombinant (His) | Mouse | HEK293 |
Neuroligin 1 (NLGN1) belongs to the type-B carboxylesterase/lipase family, is a synaptic cell-adhesion molecule that is enriched in postsynaptic densities where it may recruit receptors, channels, and signal-transduction... |