CD40 Ligand Protein, Rabbit, Recombinant (His)

Name: CD40 Ligand Protein, Rabbit, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03201
Rating: 4.5 (1 reviews)

(Synonyms: Tumor necrosis factor ligand superfamily member 5, TNLG8B, CD40LG, CD40-L, CD40 ligand) Copy Product Info

Synonyms: Tumor necrosis factor ligand superfamily member 5, TNLG8B, CD40LG, CD40-L, CD40 ligand

Catalog No. TMPH-03201 Copy Product Info

CD40 Ligand Protein, Rabbit, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.2 kDa and the accession number is G1SKP7.

Pack Size	Price	USA Stock	Global Stock
5 µg	$143	20 days	20 days
10 µg	$238	20 days	20 days
20 µg	$397	20 days	20 days
50 µg	$597	20 days	20 days
100 µg	$845	20 days	20 days
200 µg	$1,190	20 days	20 days
500 µg	$1,950	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CD40 Ligand Protein, Rabbit, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.2 kDa and the accession number is G1SKP7.
Species	Rabbit
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	G1SKP7
Amino Acid	MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL
Construction	113-261 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Tumor necrosis factor ligand superfamily member 5, TNLG8B, CD40LG, CD40-L, CD40 ligand
Research Background	N/A

Chemical Properties

Molecular Weight

18.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.