ACTC1 Protein, Human, Recombinant (Baculovirus, His)

Name: ACTC1 Protein, Human, Recombinant (Baculovirus, His)
Brand: TargetMol
SKU: TMPH-03785
Rating: 4.5 (1 reviews)

(Synonyms: Alpha-cardiac actin, alpha cardiac muscle 1, Actin, alpha cardiac muscle 1, ACTC1, ACTC) Copy Product Info

Synonyms: Alpha-cardiac actin, alpha cardiac muscle 1, Actin, alpha cardiac muscle 1, ACTC1, ACTC

Catalog No. TMPH-03785 Copy Product Info

ACTA1 Protein, Human, Recombinant (Baculovirus, His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is P68032.

ACTC1 Protein, Human, Recombinant (Baculovirus, His)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$175	20 days	20 days
10 µg	$289	20 days	20 days
20 µg	$488	20 days	20 days
50 µg	$877	20 days	20 days
100 µg	$1,370	20 days	20 days
200 µg	$1,720	20 days	20 days
500 µg	$2,350	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	ACTA1 Protein, Human, Recombinant (Baculovirus, His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is P68032.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	C-6xHis
Accession Number	P68032
Amino Acid	DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Construction	3-377 aa
Protein Purity	>90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Alpha-cardiac actin, alpha cardiac muscle 1, Actin, alpha cardiac muscle 1, ACTC1, ACTC

Chemical Properties

Molecular Weight

47.4 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

α-cardiac actinα cardiac muscle 1Actin, α cardiac muscle 1Actin, a cardiac muscle 1ACTC 1a-cardiac actina cardiac muscle 1

Related Tags: ACTC1 Protein, Human, Recombinant (Baculovirus, His) chemical structure | ACTC1 Protein, Human, Recombinant (Baculovirus, His) molecular weight